SCOPe 2.07: Domain d3lzgb1: 3lzg B:1-174

Lineage for d3lzgb1 (3lzg B:1-174)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d3lzgb1: 3lzg B:1-174 [239438]
   Other proteins in same PDB: d3lzga_, d3lzgb2, d3lzgc_, d3lzge_, d3lzgg_, d3lzgi_, d3lzgk1, d3lzgk2
   automated match to d4n5zb_
   complexed with nag

Details for d3lzgb1

PDB Entry: 3lzg, 2.6 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin

PDB Compounds: (B:) Hemagglutinin, HA2 SUBUNIT

SCOPe Domain Sequences for d3lzgb1:

Sequence; same for both SEQRES and ATOM records:

>d3lzgb1 h.3.1.1 (B:1-174) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeid

Timeline for d3lzgb1:

• d3lzgb1 first appeared in SCOPe 2.04, called d3lzgb_
  
• d3lzgb1 appears in SCOPe 2.06
  
• d3lzgb1 appears in the current release, SCOPe 2.08