Lineage for d3lzfb_ (3lzf B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709854Species Influenza A virus [TaxId:59375] [255946] (2 PDB entries)
  8. 1709855Domain d3lzfb_: 3lzf B: [239437]
    Other proteins in same PDB: d3lzfa_, d3lzfl1, d3lzfl2
    automated match to d4n5zb_
    complexed with nag

Details for d3lzfb_

PDB Entry: 3lzf (more details), 2.8 Å

PDB Description: crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
PDB Compounds: (B:) Hemagglutinin, HA2 SUBUNIT

SCOPe Domain Sequences for d3lzfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzfb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 59375]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei

SCOPe Domain Coordinates for d3lzfb_:

Click to download the PDB-style file with coordinates for d3lzfb_.
(The format of our PDB-style files is described here.)

Timeline for d3lzfb_: