SCOPe 2.08: Domain d3lieb2: 3lie B:207-300

Lineage for d3lieb2 (3lie B:207-300)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins)
   PfamB PB021678

6. Protein GGDEF family protein VP0354, C-terminal domain [419049] (1 species)
   protein is N-terminal region; consists of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle region

7. Species Vibrio parahaemolyticus [TaxId:670] [419536] (3 PDB entries)
   Uniprot Q87SR8 207-299

8. Domain d3lieb2: 3lie B:207-300 [239433]
   Other proteins in same PDB: d3liea1, d3lieb1
   automated match to d3liea2
   complexed with mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d3lieb2

PDB Entry: 3lie, 2.59 Å

PDB Description: crystal structure of the extracellular domain of the putative histidine kinase vphk1s-z8

PDB Compounds: (B:) Putative sensory box/GGDEF family protein

SCOPe Domain Sequences for d3lieb2:

Sequence; same for both SEQRES and ATOM records:

>d3lieb2 d.110.6.2 (B:207-300) GGDEF family protein VP0354, C-terminal domain {Vibrio parahaemolyticus [TaxId: 670]}
nyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagys
ysgehliafssikfvsneplhliidlsneqlskr

Timeline for d3lieb2:

• d3lieb2 first appeared in SCOPe 2.04
  
• d3lieb2 appears in SCOPe 2.07