SCOPe 2.06: Domain d3lh3f_: 3lh3 F:

Lineage for d3lh3f_ (3lh3 F:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries)

8. Domain d3lh3f_: 3lh3 F: [239426]
   automated match to d3lh3a_

Details for d3lh3f_

PDB Entry: 3lh3, 2.35 Å

PDB Description: dfp modified degs delta pdz

PDB Compounds: (F:) Protease degS

SCOPe Domain Sequences for d3lh3f_:

Sequence, based on SEQRES records:

>d3lh3f_ b.47.1.1 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fdstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkh
vindadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvl
aignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgin
tlsfdksndgetpegigfaipfqlatkimdklirdg

Sequence, based on observed residues (ATOM records):

>d3lh3f_ b.47.1.1 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fdstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkh
vindadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvl
aignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgin
tlsfdetpegigfaipfqlatkimdklirdg

Timeline for d3lh3f_:

• d3lh3f_ first appeared in SCOPe 2.04
  
• d3lh3f_ appears in SCOPe 2.05
  
• d3lh3f_ appears in SCOPe 2.07
  
• d3lh3f_ appears in the current release, SCOPe 2.08