Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries) |
Domain d3lgvc_: 3lgv C: [239415] automated match to d3lgva_ mutant |
PDB Entry: 3lgv (more details), 2.73 Å
SCOPe Domain Sequences for d3lgvc_:
Sequence, based on SEQRES records: (download)
>d3lgvc_ b.47.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} dstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhv indadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvla ignpynlgqtitqgiisatgriglnptgrqnflqtdasinpgnsggalvnslgelmgint lsfdksndgetpegigfaipfqlatkimdklirdg
>d3lgvc_ b.47.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} dstdetpasynlavrraapavvnvynrglnnqleirtlgsgvimdqrgyiitnkhvinda dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp ynlgqtitqgiisatgriglnptgrqnflqtdasinpgnsggalvnslgelmgintlsfe tpegigfaipfqlatkimdklirdg
Timeline for d3lgvc_: