| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.51.1.0: automated matches [227159] (1 protein) not a true family |
| Protein automated matches [226866] (4 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [255920] (1 PDB entry) |
| Domain d3l7zi3: 3l7z I:153-226 [239411] Other proteins in same PDB: d3l7za1, d3l7za2, d3l7zc1, d3l7zc2, d3l7zd1, d3l7zd2, d3l7zg1, d3l7zg2, d3l7zi1, d3l7zi2 automated match to d2je6i3 protein/RNA complex; complexed with so4 |
PDB Entry: 3l7z (more details), 2.41 Å
SCOPe Domain Sequences for d3l7zi3:
Sequence, based on SEQRES records: (download)
>d3l7zi3 d.51.1.0 (I:153-226) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair
kieneshikgltdr
>d3l7zi3 d.51.1.0 (I:153-226) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwateilieairkienesh
ikgltdr
Timeline for d3l7zi3: