Lineage for d3l7zi3 (3l7z I:153-226)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947194Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 2947195Protein automated matches [226866] (4 species)
    not a true protein
  7. 2947223Species Sulfolobus solfataricus [TaxId:2287] [255920] (1 PDB entry)
  8. 2947225Domain d3l7zi3: 3l7z I:153-226 [239411]
    Other proteins in same PDB: d3l7za1, d3l7za2, d3l7zc1, d3l7zc2, d3l7zd1, d3l7zd2, d3l7zg1, d3l7zg2, d3l7zi1, d3l7zi2
    automated match to d2je6i3
    protein/RNA complex; complexed with so4

Details for d3l7zi3

PDB Entry: 3l7z (more details), 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome
PDB Compounds: (I:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d3l7zi3:

Sequence, based on SEQRES records: (download)

>d3l7zi3 d.51.1.0 (I:153-226) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair
kieneshikgltdr

Sequence, based on observed residues (ATOM records): (download)

>d3l7zi3 d.51.1.0 (I:153-226) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwateilieairkienesh
ikgltdr

SCOPe Domain Coordinates for d3l7zi3:

Click to download the PDB-style file with coordinates for d3l7zi3.
(The format of our PDB-style files is described here.)

Timeline for d3l7zi3: