Lineage for d3l7zi2 (3l7z I:66-152)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789742Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1789743Protein automated matches [190576] (23 species)
    not a true protein
  7. 1789853Species Sulfolobus solfataricus [TaxId:2287] [188424] (3 PDB entries)
  8. 1789856Domain d3l7zi2: 3l7z I:66-152 [239410]
    Other proteins in same PDB: d3l7za1, d3l7za2, d3l7zc1, d3l7zc3, d3l7zd1, d3l7zd2, d3l7zg1, d3l7zg2, d3l7zi1, d3l7zi3
    automated match to d2je6i1
    protein/RNA complex; complexed with so4

Details for d3l7zi2

PDB Entry: 3l7z (more details), 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome
PDB Compounds: (I:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d3l7zi2:

Sequence, based on SEQRES records: (download)

>d3l7zi2 b.40.4.0 (I:66-152) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs

Sequence, based on observed residues (ATOM records): (download)

>d3l7zi2 b.40.4.0 (I:66-152) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgeyldvgdyviar
ienfdrsidpvlsvkgkdlgrvs

SCOPe Domain Coordinates for d3l7zi2:

Click to download the PDB-style file with coordinates for d3l7zi2.
(The format of our PDB-style files is described here.)

Timeline for d3l7zi2: