SCOPe 2.08: Domain d3l7zi1: 3l7z I:8-65

Lineage for d3l7zi1 (3l7z I:8-65)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.0: automated matches [254239] (1 protein)
   not a true family

6. Protein automated matches [254547] (1 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [255254] (2 PDB entries)

8. Domain d3l7zi1: 3l7z I:8-65 [239409]
   Other proteins in same PDB: d3l7za1, d3l7za2, d3l7zc2, d3l7zc3, d3l7zd1, d3l7zd2, d3l7zg1, d3l7zg2, d3l7zi2, d3l7zi3
   automated match to d2je6i2
   protein/RNA complex; complexed with so4

Details for d3l7zi1

PDB Entry: 3l7z, 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome

PDB Compounds: (I:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d3l7zi1:

Sequence, based on SEQRES records:

>d3l7zi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg

Sequence, based on observed residues (ATOM records):

>d3l7zi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdfevipleg

Timeline for d3l7zi1:

• d3l7zi1 first appeared in SCOPe 2.04
  
• d3l7zi1 appears in SCOPe 2.07