| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
| Protein automated matches [190576] (50 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [188424] (3 PDB entries) |
| Domain d3l7zc2: 3l7z C:66-152 [239407] Other proteins in same PDB: d3l7za1, d3l7za2, d3l7zc1, d3l7zc3, d3l7zd1, d3l7zd2, d3l7zg1, d3l7zg2, d3l7zi1, d3l7zi3 automated match to d2je6i1 protein/RNA complex; complexed with so4 |
PDB Entry: 3l7z (more details), 2.41 Å
SCOPe Domain Sequences for d3l7zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l7zc2 b.40.4.0 (C:66-152) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs
Timeline for d3l7zc2: