Lineage for d1gicb_ (1gic B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794086Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 794092Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
    Uniprot P81461
  8. 794120Domain d1gicb_: 1gic B: [23940]
    complexed with ca, mgl, mn

Details for d1gicb_

PDB Entry: 1gic (more details), 2 Å

PDB Description: concanavalin a complexed with methyl alpha-d-glucopyranoside
PDB Compounds: (B:) concanavalin a

SCOP Domain Sequences for d1gicb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gicb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1gicb_:

Click to download the PDB-style file with coordinates for d1gicb_.
(The format of our PDB-style files is described here.)

Timeline for d1gicb_: