Lineage for d3l75b2 (3l75 B:236-439)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1684579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1684848Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 1684849Protein automated matches [232766] (2 species)
    not a true protein
  7. 1684850Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 1684854Domain d3l75b2: 3l75 B:236-439 [239397]
    Other proteins in same PDB: d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75s_, d3l75t_, d3l75u_, d3l75w_
    automated match to d3l70o2
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75b2

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (B:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l75b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75b2 d.185.1.0 (B:236-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel

SCOPe Domain Coordinates for d3l75b2:

Click to download the PDB-style file with coordinates for d3l75b2.
(The format of our PDB-style files is described here.)

Timeline for d3l75b2: