Lineage for d3l74q2 (3l74 Q:196-241)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631158Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 2631203Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 2631204Protein automated matches [232791] (3 species)
    not a true protein
  7. 2631209Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)
  8. 2631213Domain d3l74q2: 3l74 Q:196-241 [239393]
    Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
    automated match to d3l70d2
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74q2

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (Q:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l74q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

SCOPe Domain Coordinates for d3l74q2:

Click to download the PDB-style file with coordinates for d3l74q2.
(The format of our PDB-style files is described here.)

Timeline for d3l74q2: