SCOPe 2.07: Domain d3l74o1: 3l74 O:18-235

Lineage for d3l74o1 (3l74 O:18-235)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)

8. Domain d3l74o1: 3l74 O:18-235 [239390]
   Other proteins in same PDB: d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
   automated match to d3l70o1
   complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74o1

PDB Entry: 3l74, 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound

PDB Compounds: (O:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l74o1:

Sequence; same for both SEQRES and ATOM records:

>d3l74o1 d.185.1.0 (O:18-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
cpgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlaspltt
kgassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwev
tdlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqn
nftsarmalvgigvkhsdlkqvaeqflnirsgagtssa

Timeline for d3l74o1:

• d3l74o1 first appeared in SCOPe 2.04
  
• d3l74o1 appears in SCOPe 2.06
  
• d3l74o1 appears in the current release, SCOPe 2.08