Lineage for d3l74b1 (3l74 B:19-235)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943314Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1943315Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1943589Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 1943590Protein automated matches [232766] (2 species)
    not a true protein
  7. 1943591Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 1943618Domain d3l74b1: 3l74 B:19-235 [239384]
    Other proteins in same PDB: d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
    automated match to d3l70o1
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74b1

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (B:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l74b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74b1 d.185.1.0 (B:19-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlasplttk
gassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwevt
dlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqnn
ftsarmalvgigvkhsdlkqvaeqflnirsgagtssa

SCOPe Domain Coordinates for d3l74b1:

Click to download the PDB-style file with coordinates for d3l74b1.
(The format of our PDB-style files is described here.)

Timeline for d3l74b1: