SCOP 1.73: Domain d1scra_: 1scr A:

Lineage for d1scra_ (1scr A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (50 PDB entries)

8. Domain d1scra_: 1scr A: [23938]
   complexed with ca, ni

Details for d1scra_

PDB Entry: 1scr, 2 Å

PDB Description: high-resolution structures of single-metal-substituted concanavalin a: the co,ca-protein at 1.6 angstroms and the ni,ca-protein at 2.0 angstroms

PDB Compounds: (A:) concanavalin a

SCOP Domain Sequences for d1scra_:

Sequence; same for both SEQRES and ATOM records:

>d1scra_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1scra_:

• d1scra_ first appeared (with stable ids) in SCOP 1.55, called d1scr__
  
• d1scra_ was called d1scr__ in SCOP 1.71
  
• d1scra_ appears in SCOP 1.75
  
• d1scra_ appears in the current release, SCOPe 2.08