Lineage for d3kurc_ (3kur C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347885Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2347886Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2347887Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 2347900Protein automated matches [191271] (2 species)
    not a true protein
  7. 2347901Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries)
  8. 2347904Domain d3kurc_: 3kur C: [239372]
    automated match to d3kura_
    complexed with cl

Details for d3kurc_

PDB Entry: 3kur (more details), 2.5 Å

PDB Description: Crystal structure of the MLLE domain of poly(A)-binding protein
PDB Compounds: (C:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d3kurc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kurc_ a.144.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespesl
rskvdeavavlq

SCOPe Domain Coordinates for d3kurc_:

Click to download the PDB-style file with coordinates for d3kurc_.
(The format of our PDB-style files is described here.)

Timeline for d3kurc_: