![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) ![]() |
![]() | Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins) |
![]() | Protein automated matches [191271] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries) |
![]() | Domain d3kurc_: 3kur C: [239372] automated match to d3kura_ complexed with cl |
PDB Entry: 3kur (more details), 2.5 Å
SCOPe Domain Sequences for d3kurc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kurc_ a.144.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespesl rskvdeavavlq
Timeline for d3kurc_: