Lineage for d3ku6b_ (3ku6 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970146Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)
  8. 1970149Domain d3ku6b_: 3ku6 B: [239370]
    Other proteins in same PDB: d3ku6a_
    automated match to d2viub_
    complexed with edo, nag, peg

Details for d3ku6b_

PDB Entry: 3ku6 (more details), 1.75 Å

PDB Description: crystal structure of a h2n2 influenza virus hemagglutinin, 226l/228g
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3ku6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ku6b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d3ku6b_:

Click to download the PDB-style file with coordinates for d3ku6b_.
(The format of our PDB-style files is described here.)

Timeline for d3ku6b_: