![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (27 species) not a true protein |
![]() | Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries) |
![]() | Domain d3ku6b_: 3ku6 B: [239370] Other proteins in same PDB: d3ku6a_ automated match to d2viub_ complexed with edo, nag, peg |
PDB Entry: 3ku6 (more details), 1.75 Å
SCOPe Domain Sequences for d3ku6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ku6b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 387161]} glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne
Timeline for d3ku6b_: