Lineage for d1dq6a_ (1dq6 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371128Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 371134Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (47 PDB entries)
  8. 371143Domain d1dq6a_: 1dq6 A: [23937]

Details for d1dq6a_

PDB Entry: 1dq6 (more details), 1.9 Å

PDB Description: manganese;manganese concanavalin a at ph 7.0

SCOP Domain Sequences for d1dq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq6a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis)}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1dq6a_:

Click to download the PDB-style file with coordinates for d1dq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1dq6a_: