SCOPe 2.05: Domain d3ku5b_: 3ku5 B:

Lineage for d3ku5b_ (3ku5 B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza A virus [TaxId:387161] [255913] (6 PDB entries)

8. Domain d3ku5b_: 3ku5 B: [239369]
   Other proteins in same PDB: d3ku5a_
   automated match to d2viub_
   complexed with edo, nag, peg

Details for d3ku5b_

PDB Entry: 3ku5, 1.73 Å

PDB Description: crystal structure of a h2n2 influenza virus hemagglutinin, human like

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3ku5b_:

Sequence; same for both SEQRES and ATOM records:

>d3ku5b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 387161]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

Timeline for d3ku5b_:

• d3ku5b_ first appeared in SCOPe 2.04
  
• d3ku5b_ appears in SCOPe 2.06
  
• d3ku5b_ appears in the current release, SCOPe 2.08