Class a: All alpha proteins [46456] (289 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
Protein automated matches [190464] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries) |
Domain d3krwa1: 3krw A:30-185 [239365] Other proteins in same PDB: d3krwa2, d3krwa3, d3krwb_, d3krwg_ automated match to d1omwa1 complexed with ba1, mg |
PDB Entry: 3krw (more details), 2.9 Å
SCOPe Domain Sequences for d3krwa1:
Sequence, based on SEQRES records: (download)
>d3krwa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
>d3krwa1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei kkyekleteeervarsreifdsyimkellahpfsksatehvqghlgkkqvppdlfqpyie eicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d3krwa1: