SCOP 1.75: Domain d2ctva_: 2ctv A:

Lineage for d2ctva_ (2ctv A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
   Uniprot P81461

8. Domain d2ctva_: 2ctv A: [23936]
   complexed with ca, mn

Details for d2ctva_

PDB Entry: 2ctv, 1.95 Å

PDB Description: high resolution crystallographic studies of native concanavalin a using rapid laue data collection methods and the introduction of a monochromatic large-angle oscillation technique (lot)

PDB Compounds: (A:) concanavalin a

SCOP Domain Sequences for d2ctva_:

Sequence; same for both SEQRES and ATOM records:

>d2ctva_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d2ctva_:

• d2ctva_ first appeared (with stable ids) in SCOP 1.55
  
• d2ctva_ appears in SCOP 1.73
  
• d2ctva_ appears in SCOPe 2.01
  
• d2ctva_ appears in the current release, SCOPe 2.08