SCOPe 2.08: Domain d3il3a2: 3il3 A:174-316

Lineage for d3il3a2 (3il3 A:174-316)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [232599] (1 PDB entry)

8. Domain d3il3a2: 3il3 A:174-316 [239358]

Details for d3il3a2

PDB Entry: 3il3, 2.7 Å

PDB Description: Structure of Haemophilus influenzae FabH

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d3il3a2:

Sequence; same for both SEQRES and ATOM records:

>d3il3a2 c.95.1.0 (A:174-316) automated matches {Haemophilus influenzae [TaxId: 727]}
iisthlhasadknnalvlaqpergieksgyiemqgnetfklavrelsnvveetllannld
kkdldwlvphqanlriitatakklemdmsqvvvtldkyannsaatvpvaldeairdgriq
rgqlllleafgggwtwgsalvrf

Timeline for d3il3a2:

• d3il3a2 first appeared in SCOPe 2.04
  
• d3il3a2 appears in SCOPe 2.07