SCOPe 2.08: Domain d3ii6c2: 3ii6 C:118-201

Lineage for d3ii6c2 (3ii6 C:118-201)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.11: XRCC4, C-terminal oligomerization domain [58022] (2 families)

5. Family h.1.11.1: XRCC4, C-terminal oligomerization domain [58023] (1 protein)

6. Protein XRCC4, C-terminal oligomerization domain [58024] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58025] (4 PDB entries)

8. Domain d3ii6c2: 3ii6 C:118-201 [239355]
   Other proteins in same PDB: d3ii6a1, d3ii6b1, d3ii6c1, d3ii6d1
   protein/DNA complex; complexed with cl

Details for d3ii6c2

PDB Entry: 3ii6, 2.4 Å

PDB Description: structure of human xrcc4 in complex with the tandem brct domains of dna ligaseiv.

PDB Compounds: (C:) DNA repair protein xrcc4

SCOPe Domain Sequences for d3ii6c2:

Sequence; same for both SEQRES and ATOM records:

>d3ii6c2 h.1.11.1 (C:118-201) XRCC4, C-terminal oligomerization domain {Human (Homo sapiens) [TaxId: 9606]}
npaevirelicycldttaenqaknehlqkenerllrdwndvqgrfekcvsakealetdly
krfilvlnekktkirslhnkllna

Timeline for d3ii6c2:

• d3ii6c2 first appeared in SCOPe 2.04
  
• d3ii6c2 appears in SCOPe 2.07