Lineage for d3i6bc_ (3i6b C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1883997Species Escherichia coli [TaxId:562] [225534] (4 PDB entries)
  8. 1884015Domain d3i6bc_: 3i6b C: [239351]
    automated match to d3i6bb_
    complexed with kdo, mg, po4

Details for d3i6bc_

PDB Entry: 3i6b (more details), 2.49 Å

PDB Description: crystal structure of yrbi lacking the last 8 residues, in complex with kdo and inorganic phosphate
PDB Compounds: (C:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3i6bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6bc_ c.108.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
aslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygirca
ltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgd
dlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl

SCOPe Domain Coordinates for d3i6bc_:

Click to download the PDB-style file with coordinates for d3i6bc_.
(The format of our PDB-style files is described here.)

Timeline for d3i6bc_: