Lineage for d3hv2b_ (3hv2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856075Species Pseudomonas fluorescens [TaxId:220664] [232518] (1 PDB entry)
  8. 2856077Domain d3hv2b_: 3hv2 B: [239346]
    automated match to d3hv2a_
    complexed with so4

Details for d3hv2b_

PDB Entry: 3hv2 (more details), 1.5 Å

PDB Description: crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5
PDB Compounds: (B:) Response regulator/HD domain protein

SCOPe Domain Sequences for d3hv2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hv2b_ c.23.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisaahlpqmd
gptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelllalrqale
hqhse

SCOPe Domain Coordinates for d3hv2b_:

Click to download the PDB-style file with coordinates for d3hv2b_.
(The format of our PDB-style files is described here.)

Timeline for d3hv2b_: