Lineage for d3httb_ (3htt B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041565Species Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [255864] (4 PDB entries)
  8. 3041567Domain d3httb_: 3htt B: [239345]
    Other proteins in same PDB: d3htta_
    automated match to d1ruzi_
    complexed with nag

Details for d3httb_

PDB Entry: 3htt (more details), 2.95 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with 2,3-sialyllactose
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3httb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3httb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
glfgamagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsiiekmn
tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp

SCOPe Domain Coordinates for d3httb_:

Click to download the PDB-style file with coordinates for d3httb_.
(The format of our PDB-style files is described here.)

Timeline for d3httb_: