Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [255864] (4 PDB entries) |
Domain d3htqb_: 3htq B: [239344] Other proteins in same PDB: d3htqa_ automated match to d1ruzi_ complexed with nag |
PDB Entry: 3htq (more details), 2.96 Å
SCOPe Domain Sequences for d3htqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3htqb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]} glfgamagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsiiekmn tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp
Timeline for d3htqb_: