SCOPe 2.08: Domain d3htqb_: 3htq B:

Lineage for d3htqb_ (3htq B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [255864] (4 PDB entries)

8. Domain d3htqb_: 3htq B: [239344]
   Other proteins in same PDB: d3htqa_
   automated match to d1ruzi_
   complexed with nag

Details for d3htqb_

PDB Entry: 3htq, 2.96 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with lstc

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3htqb_:

Sequence; same for both SEQRES and ATOM records:

>d3htqb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
glfgamagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsiiekmn
tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp

Timeline for d3htqb_:

• d3htqb_ first appeared in SCOPe 2.04
  
• d3htqb_ appears in SCOPe 2.07