SCOPe 2.05: Domain d3htpb_: 3htp B:

Lineage for d3htpb_ (3htp B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [255864] (4 PDB entries)

8. Domain d3htpb_: 3htp B: [239343]
   Other proteins in same PDB: d3htpa_
   automated match to d1ruzi_
   complexed with nag

Details for d3htpb_

PDB Entry: 3htp, 2.96 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with lsta

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3htpb_:

Sequence; same for both SEQRES and ATOM records:

>d3htpb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
glfgamagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsiiekmn
tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp

Timeline for d3htpb_:

• d3htpb_ first appeared in SCOPe 2.04
  
• d3htpb_ appears in SCOPe 2.06
  
• d3htpb_ appears in the current release, SCOPe 2.08