Lineage for d3htpb_ (3htp B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970035Species Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [255864] (4 PDB entries)
  8. 1970038Domain d3htpb_: 3htp B: [239343]
    Other proteins in same PDB: d3htpa_
    automated match to d1ruzi_
    complexed with nag

Details for d3htpb_

PDB Entry: 3htp (more details), 2.96 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with lsta
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3htpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3htpb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
glfgamagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsiiekmn
tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp

SCOPe Domain Coordinates for d3htpb_:

Click to download the PDB-style file with coordinates for d3htpb_.
(The format of our PDB-style files is described here.)

Timeline for d3htpb_: