Lineage for d3hssa1 (3hss A:2-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902533Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries)
  8. 2902534Domain d3hssa1: 3hss A:2-261 [239341]
    Other proteins in same PDB: d3hssa2
    automated match to d3hssb_
    complexed with act, edo, mla, na, trs

Details for d3hssa1

PDB Entry: 3hss (more details), 1.9 Å

PDB Description: a higher resolution structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
PDB Compounds: (A:) putative Bromoperoxidase

SCOPe Domain Sequences for d3hssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hssa1 c.69.1.0 (A:2-261) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
fferpeavntamlkffasvk

SCOPe Domain Coordinates for d3hssa1:

Click to download the PDB-style file with coordinates for d3hssa1.
(The format of our PDB-style files is described here.)

Timeline for d3hssa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hssa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hssb_