Lineage for d3hp0f_ (3hp0 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853622Species Bacillus subtilis [TaxId:1423] [232498] (1 PDB entry)
  8. 2853628Domain d3hp0f_: 3hp0 F: [239340]
    automated match to d3hp0b_

Details for d3hp0f_

PDB Entry: 3hp0 (more details), 2.32 Å

PDB Description: crystal structure of a putative polyketide biosynthesis enoyl-coa hydratase (pksh) from bacillus subtilis
PDB Compounds: (F:) Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH

SCOPe Domain Sequences for d3hp0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hp0f_ c.14.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
iiryvetgqfp

SCOPe Domain Coordinates for d3hp0f_:

Click to download the PDB-style file with coordinates for d3hp0f_.
(The format of our PDB-style files is described here.)

Timeline for d3hp0f_: