Lineage for d3h7fb1 (3h7f B:1-426)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132697Species Mycobacterium tuberculosis [TaxId:1773] [225404] (27 PDB entries)
  8. 2132703Domain d3h7fb1: 3h7f B:1-426 [239337]
    Other proteins in same PDB: d3h7fa2, d3h7fb2
    automated match to d3h7fa_
    complexed with mg

Details for d3h7fb1

PDB Entry: 3h7f (more details), 1.5 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from mycobacterium tuberculosis
PDB Compounds: (B:) Serine hydroxymethyltransferase 1

SCOPe Domain Sequences for d3h7fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h7fb1 c.67.1.0 (B:1-426) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msaplaevdpdiaellakelgrqrdtlemiasenfvpravlqaqgsvltnkyaeglpgrr
yyggcehvdvvenlardrakalfgaefanvqphsgaqanaavlhalmspgerllgldlan
gghlthgmrlnfsgklyengfygvdpathlidmdavratalefrpkviiagwsayprvld
faafrsiadevgakllvdmahfaglvaaglhpspvphadvvsttvhktlgggrsglivgk
qqyakainsavfpgqqggplmhviagkavalkiaatpefadrqrrtlsgariiadrlmap
dvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhevgitvnrnavpndprppmvts
glrigtpalatrgfgdteftevadiiatalatgssvdvsalkdratrlarafplydglee
wslvgr

SCOPe Domain Coordinates for d3h7fb1:

Click to download the PDB-style file with coordinates for d3h7fb1.
(The format of our PDB-style files is described here.)

Timeline for d3h7fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h7fb2