| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (6 species) not a true protein |
| Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232387] (2 PDB entries) |
| Domain d3h4el2: 3h4e L:148-219 [239336] Other proteins in same PDB: d3h4ea1, d3h4eb1, d3h4ec1, d3h4ed1, d3h4ee1, d3h4ef1, d3h4eg1, d3h4eh1, d3h4ei1, d3h4ej1, d3h4ek1, d3h4el1 automated match to d3h47a2 |
PDB Entry: 3h4e (more details), 2.7 Å
SCOPe Domain Sequences for d3h4el2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h4el2 a.28.3.0 (L:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq
Timeline for d3h4el2: