![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (20 species) not a true protein |
![]() | Species Comamonas testosteroni [TaxId:285] [232354] (2 PDB entries) |
![]() | Domain d3gzya2: 3gzy A:179-457 [239332] Other proteins in same PDB: d3gzya1, d3gzyb_ automated match to d3gzxa2 complexed with fe2, fes, mes |
PDB Entry: 3gzy (more details), 1.62 Å
SCOPe Domain Sequences for d3gzya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzya2 d.129.3.0 (A:179-457) automated matches {Comamonas testosteroni [TaxId: 285]} eapdlktylsdampymdvmldrteagteaiggiqkwvipcnwkfaaeqfcsdmyhagtms hlsgvlaglppemdltqiqlskngnqfrsawgghgagwfindssillsvvgpkitqywtq gpaaekaarrvpqlpildmfgqhmtvfptcsflpgintirtwhprgpnevevwafvlvda dapedikeefrlqnirtfnaggvfeqddgenwveiqrvmrghkakstslcakmglnvpnk nnpaypgktayvyaeeaargmyhhwsrmmsepswdtlkp
Timeline for d3gzya2: