Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Phospholipase C-gamma-1 [55577] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [226824] (3 PDB entries) |
Domain d3gqib2: 3gqi B:659-770 [239326] Other proteins in same PDB: d3gqia_ automated match to d1qada_ complexed with acp, dvt, mg |
PDB Entry: 3gqi (more details), 2.5 Å
SCOPe Domain Sequences for d3gqib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqib2 d.93.1.1 (B:659-770) Phospholipase C-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qtnaheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvq qegqtvmlgnsefdslvdlisyyekhplyrkmklrypineealekigtaepd
Timeline for d3gqib2: