SCOPe 2.04: Domain d3gfvb_: 3gfv B:

Lineage for d3gfvb_ (3gfv B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (23 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [232282] (2 PDB entries)

8. Domain d3gfvb_: 3gfv B: [239320]
   automated match to d3gfva_
   complexed with asn, po4

Details for d3gfvb_

PDB Entry: 3gfv, 1.75 Å

PDB Description: crystal structure of petrobactin-binding protein yclq from bacillu subtilis

PDB Compounds: (B:) Uncharacterized ABC transporter solute-binding protein yclQ

SCOPe Domain Sequences for d3gfvb_:

Sequence; same for both SEQRES and ATOM records:

>d3gfvb_ c.92.2.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
keqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivaglpkqvlpkylskfk
ddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiylgvdtakymesfk
sdaetigkifdkedkvkdelanidhsiadvkktaeklnknglvimandgkisafgpksry
glihdvfgvapadqnikasthgqsvsyeyisktnpdylfvidrgtaigetsstkqvvend
yvknvnavknghviyldsatwylsggglesmtqmikevkdgleke

Timeline for d3gfvb_:

• d3gfvb_ is new in SCOPe 2.04-stable
  
• d3gfvb_ appears in SCOPe 2.05
  
• d3gfvb_ appears in the current release, SCOPe 2.08, called d3gfvb1