Lineage for d3gcfo2 (3gcf O:149-382)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582636Species Nocardioides aromaticivorans [TaxId:200618] [232264] (1 PDB entry)
  8. 2582651Domain d3gcfo2: 3gcf O:149-382 [239319]
    Other proteins in same PDB: d3gcfa1, d3gcfb1, d3gcfc1, d3gcfd1, d3gcfe1, d3gcff1, d3gcfg1, d3gcfh1, d3gcfi1, d3gcfj1, d3gcfk1, d3gcfl1, d3gcfm1, d3gcfn1, d3gcfo1
    automated match to d3gcfa2
    complexed with cl, fe2, fes

Details for d3gcfo2

PDB Entry: 3gcf (more details), 2.3 Å

PDB Description: Terminal oxygenase of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177
PDB Compounds: (O:) Terminal oxygenase component of carbazole 1,9a-dioxygenase

SCOPe Domain Sequences for d3gcfo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gcfo2 d.129.3.0 (O:149-382) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
halsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrnspwvsgnrlafpy
gfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsaeltgeekkvaaqvsv
wlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvktfevefeerwrdd
alhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlasergrgvra

SCOPe Domain Coordinates for d3gcfo2:

Click to download the PDB-style file with coordinates for d3gcfo2.
(The format of our PDB-style files is described here.)

Timeline for d3gcfo2: