Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries) |
Domain d3gcfo1: 3gcf O:16-148 [239318] Other proteins in same PDB: d3gcfa2, d3gcfb2, d3gcfc2, d3gcfd2, d3gcfe2, d3gcff2, d3gcfg2, d3gcfh2, d3gcfi2, d3gcfj2, d3gcfk2, d3gcfl2, d3gcfm2, d3gcfn2, d3gcfo2 automated match to d3gcfa1 complexed with cl, fe2, fes |
PDB Entry: 3gcf (more details), 2.3 Å
SCOPe Domain Sequences for d3gcfo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gcfo1 b.33.1.0 (O:16-148) automated matches {Nocardioides aromaticivorans [TaxId: 200618]} saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva qgvvfvfigdeep
Timeline for d3gcfo1:
View in 3D Domains from other chains: (mouse over for more information) d3gcfa1, d3gcfa2, d3gcfb1, d3gcfb2, d3gcfc1, d3gcfc2, d3gcfd1, d3gcfd2, d3gcfe1, d3gcfe2, d3gcff1, d3gcff2, d3gcfg1, d3gcfg2, d3gcfh1, d3gcfh2, d3gcfi1, d3gcfi2, d3gcfj1, d3gcfj2, d3gcfk1, d3gcfk2, d3gcfl1, d3gcfl2, d3gcfm1, d3gcfm2, d3gcfn1, d3gcfn2 |