SCOPe 2.08: Domain d3gcfd2: 3gcf D:149-382

Lineage for d3gcfd2 (3gcf D:149-382)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Nocardioides aromaticivorans [TaxId:200618] [232264] (1 PDB entry)

8. Domain d3gcfd2: 3gcf D:149-382 [239297]
   Other proteins in same PDB: d3gcfa1, d3gcfb1, d3gcfc1, d3gcfd1, d3gcfe1, d3gcff1, d3gcfg1, d3gcfh1, d3gcfi1, d3gcfj1, d3gcfk1, d3gcfl1, d3gcfm1, d3gcfn1, d3gcfo1
   automated match to d3gcfa2
   complexed with cl, fe2, fes

Details for d3gcfd2

PDB Entry: 3gcf, 2.3 Å

PDB Description: Terminal oxygenase of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177

PDB Compounds: (D:) Terminal oxygenase component of carbazole 1,9a-dioxygenase

SCOPe Domain Sequences for d3gcfd2:

Sequence; same for both SEQRES and ATOM records:

>d3gcfd2 d.129.3.0 (D:149-382) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
halsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrnspwvsgnrlafpy
gfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsaeltgeekkvaaqvsv
wlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvktfevefeerwrdd
alhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlasergrgvra

Timeline for d3gcfd2:

• d3gcfd2 first appeared in SCOPe 2.04
  
• d3gcfd2 appears in SCOPe 2.07