Lineage for d3gbnb_ (3gbn B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266928Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [255844] (1 PDB entry)
  8. 2266929Domain d3gbnb_: 3gbn B: [239295]
    Other proteins in same PDB: d3gbna1, d3gbna2, d3gbnl1
    automated match to d4n5zb_
    complexed with cl, edo, etx, gol, nag, unl

Details for d3gbnb_

PDB Entry: 3gbn (more details), 2.2 Å

PDB Description: crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3gbnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbnb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei

SCOPe Domain Coordinates for d3gbnb_:

Click to download the PDB-style file with coordinates for d3gbnb_.
(The format of our PDB-style files is described here.)

Timeline for d3gbnb_: