Lineage for d3gbmd_ (3gbm D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041248Domain d3gbmd_: 3gbm D: [239294]
    Other proteins in same PDB: d3gbma1, d3gbma2, d3gbmb2, d3gbmc1, d3gbmc2, d3gbmh_, d3gbmi_, d3gbml1, d3gbml2, d3gbmm1, d3gbmm2
    automated match to d4n5zb_
    complexed with bma, edo, gol, nag

Details for d3gbmd_

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d3gbmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbmd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreei

SCOPe Domain Coordinates for d3gbmd_:

Click to download the PDB-style file with coordinates for d3gbmd_.
(The format of our PDB-style files is described here.)

Timeline for d3gbmd_: