Lineage for d3gbmb_ (3gbm B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969660Domain d3gbmb_: 3gbm B: [239293]
    Other proteins in same PDB: d3gbma_, d3gbmc_, d3gbml1, d3gbml2, d3gbmm1, d3gbmm2
    automated match to d4n5zb_
    complexed with bma, edo, gol, nag

Details for d3gbmb_

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3gbmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr

SCOPe Domain Coordinates for d3gbmb_:

Click to download the PDB-style file with coordinates for d3gbmb_.
(The format of our PDB-style files is described here.)

Timeline for d3gbmb_: