SCOPe 2.06: Domain d3fefd2: 3fef D:172-440

Lineage for d3fefd2 (3fef D:172-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
   family 4 glycosyl hydrolase
   automatically mapped to Pfam PF11975

6. Protein automated matches [227094] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [256397] (1 PDB entry)

8. Domain d3fefd2: 3fef D:172-440 [239277]
   Other proteins in same PDB: d3fefa1, d3fefb1, d3fefc1, d3fefd1
   complexed with mg, so4

Details for d3fefd2

PDB Entry: 3fef, 2.2 Å

PDB Description: crystal structure of putative glucosidase lpld from bacillus subtilis

PDB Compounds: (D:) Putative glucosidase lplD, ALPHA-GALACTURONIDASE

SCOPe Domain Sequences for d3fefd2:

Sequence; same for both SEQRES and ATOM records:

>d3fefd2 d.162.1.2 (D:172-440) automated matches {Bacillus subtilis [TaxId: 1423]}
cchevfgtqkllaemvterlgievprredirvnvlginhftwitkasyrhidllpifref
sahygesgyelegecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpev
wkfhltpisfrkqdraekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnm
pnqgqvlnlpiqaivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkd
tglafqaflndplvqidrsdaeqlfndml

Timeline for d3fefd2:

• d3fefd2 first appeared in SCOPe 2.04
  
• d3fefd2 appears in SCOPe 2.05
  
• d3fefd2 appears in SCOPe 2.07
  
• d3fefd2 appears in the current release, SCOPe 2.08