![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
![]() | Protein automated matches [227094] (3 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [256397] (1 PDB entry) |
![]() | Domain d3fefd2: 3fef D:172-440 [239277] Other proteins in same PDB: d3fefa1, d3fefb1, d3fefc1, d3fefd1 complexed with mg, so4 |
PDB Entry: 3fef (more details), 2.2 Å
SCOPe Domain Sequences for d3fefd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fefd2 d.162.1.2 (D:172-440) automated matches {Bacillus subtilis [TaxId: 1423]} cchevfgtqkllaemvterlgievprredirvnvlginhftwitkasyrhidllpifref sahygesgyelegecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpev wkfhltpisfrkqdraekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnm pnqgqvlnlpiqaivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkd tglafqaflndplvqidrsdaeqlfndml
Timeline for d3fefd2: