Lineage for d3fefd2 (3fef D:172-440)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680789Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 1680828Protein automated matches [227094] (2 species)
    not a true protein
  7. 1680829Species Bacillus subtilis [TaxId:1423] [256397] (1 PDB entry)
  8. 1680833Domain d3fefd2: 3fef D:172-440 [239277]
    Other proteins in same PDB: d3fefa1, d3fefb1, d3fefc1, d3fefd1
    complexed with mg, so4

Details for d3fefd2

PDB Entry: 3fef (more details), 2.2 Å

PDB Description: crystal structure of putative glucosidase lpld from bacillus subtilis
PDB Compounds: (D:) Putative glucosidase lplD, ALPHA-GALACTURONIDASE

SCOPe Domain Sequences for d3fefd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fefd2 d.162.1.2 (D:172-440) automated matches {Bacillus subtilis [TaxId: 1423]}
cchevfgtqkllaemvterlgievprredirvnvlginhftwitkasyrhidllpifref
sahygesgyelegecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpev
wkfhltpisfrkqdraekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnm
pnqgqvlnlpiqaivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkd
tglafqaflndplvqidrsdaeqlfndml

SCOPe Domain Coordinates for d3fefd2:

Click to download the PDB-style file with coordinates for d3fefd2.
(The format of our PDB-style files is described here.)

Timeline for d3fefd2: