SCOPe 2.04: Domain d3fefb2: 3fef B:172-440

Lineage for d3fefb2 (3fef B:172-440)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
   family 4 glycosyl hydrolase
   automatically mapped to Pfam PF11975

6. Protein automated matches [227094] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [256397] (1 PDB entry)

8. Domain d3fefb2: 3fef B:172-440 [239275]
   Other proteins in same PDB: d3fefa1, d3fefb1, d3fefc1, d3fefd1
   complexed with mg, so4

Details for d3fefb2

PDB Entry: 3fef, 2.2 Å

PDB Description: crystal structure of putative glucosidase lpld from bacillus subtilis

PDB Compounds: (B:) Putative glucosidase lplD, ALPHA-GALACTURONIDASE

SCOPe Domain Sequences for d3fefb2:

Sequence; same for both SEQRES and ATOM records:

>d3fefb2 d.162.1.2 (B:172-440) automated matches {Bacillus subtilis [TaxId: 1423]}
cchevfgtqkllaemvterlgievprredirvnvlginhftwitkasyrhidllpifref
sahygesgyelegecwrdsvfcsahrvafdlfetygaipaagdrhlaeflpgpylkqpev
wkfhltpisfrkqdraekrqeterlivqqrgvaekasgeegvniiaallglgelvtnvnm
pnqgqvlnlpiqaivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkd
tglafqaflndplvqidrsdaeqlfndml

Timeline for d3fefb2:

• d3fefb2 is new in SCOPe 2.04-stable
  
• d3fefb2 appears in SCOPe 2.05
  
• d3fefb2 appears in the current release, SCOPe 2.08