![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Integrin beta-4 subunit [49278] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries) |
![]() | Domain d3f7pc2: 3f7p C:1218-1330 [239271] Other proteins in same PDB: d3f7pa1, d3f7pa2, d3f7pb1, d3f7pb2 automated match to d1qg3a2 complexed with ca, edo, peg |
PDB Entry: 3f7p (more details), 2.75 Å
SCOPe Domain Sequences for d3f7pc2:
Sequence, based on SEQRES records: (download)
>d3f7pc2 b.1.2.1 (C:1218-1330) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn pknrmllienlresqpyrytvkarngagwgpereaiinlatqpkrpmsipiip
>d3f7pc2 b.1.2.1 (C:1218-1330) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn pknrmllienlresqpyrytvkarngagwgpereaiinlatqmsipiip
Timeline for d3f7pc2: