SCOPe 2.06: Domain d3f7pc1: 3f7p C:1127-1217

Lineage for d3f7pc1 (3f7p C:1127-1217)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families)
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Integrin beta-4 subunit [49278] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries)
Domain d3f7pc1: 3f7p C:1127-1217 [239270]
Other proteins in same PDB: d3f7pa1, d3f7pa2, d3f7pb1, d3f7pb2
automated match to d1qg3a1
complexed with ca, edo, peg

Details for d3f7pc1

PDB Entry: 3f7p (more details), 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin

PDB Compounds: (C:) Integrin beta-4

SCOPe Domain Sequences for d3f7pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7pc1 b.1.2.1 (C:1127-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
lgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltnl
ypycdyemkvcaygaqgegpysslvscrthq

SCOPe Domain Coordinates for d3f7pc1:

Click to download the PDB-style file with coordinates for d3f7pc1.
(The format of our PDB-style files is described here.)

Timeline for d3f7pc1: