| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Integrin beta-4 subunit [49278] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries) |
| Domain d3f7pc1: 3f7p C:1127-1217 [239270] Other proteins in same PDB: d3f7pa1, d3f7pa2, d3f7pb1, d3f7pb2 automated match to d1qg3a1 complexed with ca, edo, peg |
PDB Entry: 3f7p (more details), 2.75 Å
SCOPe Domain Sequences for d3f7pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7pc1 b.1.2.1 (C:1127-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
lgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltnl
ypycdyemkvcaygaqgegpysslvscrthq
Timeline for d3f7pc1: